PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G26020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 372aa    MW: 36857 Da    PI: 8.5769
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G26020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3944104262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+s+
  ONIVA03G26020.1  44 QEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 104
                      57889*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.9E-3346102IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-244797IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60948102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MAPAAGDDAV VPRKGAGGGG TTTPPQPPPA QQQQQQPLPP PPPQEQGLRC PRCDSPNTKF  60
CYYNNYSLSQ PRHFCKTCRR YWTKGGALRN VPVGGGCRKN KRSRSAAAAS RLSLNLPTVE  120
GIGGAAADPA AAAAARLGFL GGGTTMMMSS STSPLGGAAA AVADFQQGGA VGMLPLPRLQ  180
SPAGGGVGHH QYVPFGEWPS GDIAGGNAVN GGGGHGAVSS TIASSIESLS FINQDLHWKL  240
QQQRLATMFL GPPGSASAAA QANDGGGNGA QATASGHAAG GGGGAFMHMA GSVPSMEAAM  300
PSATSWFMDS CSYGLPSPPP PATAAVAATT SSNLNSGGRS SGGGGGGDDN ATSNCGSAIP  360
AWGDISTFAM LP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1336344GGRSSGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630014.11e-161PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A0E0GQ510.0A0A0E0GQ51_ORYNI; Uncharacterized protein
STRINGLOC_Os03g38870.11e-160(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-30DOF zinc finger protein 1